PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AS_0ADC996F5.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GATA
Protein Properties Length: 324aa    MW: 37270.8 Da    PI: 7.2583
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AS_0ADC996F5.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.31.8e-17246280135
                   GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                            C++C + +Tp+WR+gp g+ktLCnaCG++y++ +l
  Traes_5AS_0ADC996F5.1 246 CTHCLSHTTPQWRSGPLGPKTLCNACGVRYKSGRL 280
                            *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.2E-4127180IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.0E-4132166IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS501148.629136165IPR000679Zinc finger, GATA-type
SMARTSM004013.6E-16240294IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.543240276IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.66E-14244304No hitNo description
Gene3DG3DSA:3.30.50.102.4E-13245278IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.68E-13245292No hitNo description
PROSITE patternPS003440246271IPR000679Zinc finger, GATA-type
PfamPF003202.5E-15246280IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
QFCLKGSSGL ESEDSSTEWL SIYLEDCLTN PASYPVSEEQ ASVNPNLPHP SSSNPRRKKR  60
SLASVIRDSD EEYFLIVEPP LLLDQKHWLA ESELILPKKD KDQELVQKLE QEHEEEYKPY  120
TVQFKQEQAV MRCSICLSNS NQTPQQWQGG PSGALLCNTC SLRLKAGNGF IKLERCGQQV  180
DEEQDHGRGQ DKRKIKKTTY YGDDEEPPQE KRRIKKTSFV DEQGKRRTKK TYVNEEVPLE  240
EPVKRCTHCL SHTTPQWRSG PLGPKTLCNA CGVRYKSGRL LPEYRPANSP TFVSFMHSNS  300
HKKVMQMRKS VENEHEHEYS HSDM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00415DAPTransfer from AT3G60530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2562810.0AC256281.1 Hordeum vulgare clone HV_Mba475-H03, complete sequence.
GenBankAK2517110.0AK251711.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf124o21, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579113.11e-121PREDICTED: GATA transcription factor 2-like
TrEMBLW5F3M00.0W5F3M0_WHEAT; Uncharacterized protein
STRINGBRADI4G01140.11e-120(Brachypodium distachyon)
STRINGMLOC_22000.11e-122(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.17e-36GATA transcription factor 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]